TA335926 CT47 antibody

Rabbit Polyclonal Anti-CT47A7 Antibody

See related secondary antibodies

Search for all "CT47"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CT47

Product Description for CT47

Rabbit anti Human CT47.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CT47

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CT47.11, CT47A1, CT47A10, CT47A11, CT47A12, CT47A2, CT47A3, CT47A4, CT47A5, CT47A6, CT47A7, CT47A8, CT47A9, Cancer/testis antigen 47A, RP6-166C19.11
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5JQC4
Immunogen:
The immunogen for Anti-CT47A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human CT47A7. Synthetic peptide located within the following region: PDAEEPATEEPTAQEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKD.
GeneID:
100507170
Application WB
Background This locus represents a member of the cancer/testis gene family 47. This family, also known as CT47, is comprised of 13 nearly identical loci clustered at Xq24.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CT47 (2 products)

Catalog No. Species Pres. Purity   Source  

CT47

CT47 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CT47

CT47 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CT47 (9 products)

Catalog No. Species Pres. Purity   Source  

CT47A1 overexpression lysate

CT47A1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CT47A2 overexpression lysate

CT47A2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CT47A3 overexpression lysate

CT47A3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CT47A5 overexpression lysate

CT47A5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CT47A6 overexpression lysate

CT47A6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CT47A7 overexpression lysate

CT47A7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CT47A8 overexpression lysate

CT47A8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CT47A9 overexpression lysate

CT47A9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CT47A10 overexpression lysate

CT47A10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn