TA335929 KIAA1191 antibody

Rabbit Polyclonal Anti-KIAA1191 Antibody

See related secondary antibodies

Search for all "KIAA1191"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human KIAA1191

Product Description for KIAA1191

Rabbit anti Canine, Human KIAA1191.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIAA1191

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Brain-derived rescue factor p60MONOX, UPF0498 protein KIAA1191, p60MONOX
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96A73
Immunogen:
The immunogen for Anti-KIAA1191 Antibody: synthetic peptide directed towards the middle region of human KIAA1191. Synthetic peptide located within the following region: TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP.
GeneID:
57179
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KIAA1191 (4 products)

Catalog No. Species Pres. Purity   Source  

KIAA1191 (transcript variant 3)

KIAA1191 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KIAA1191 (transcript variant 1)

KIAA1191 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KIAA1191

KIAA1191 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

KIAA1191

KIAA1191 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for KIAA1191 (3 products)

Catalog No. Species Pres. Purity   Source  

KIAA1191 Lysate

Western Blot: KIAA1191 Lysate [NBL1-12261] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KIAA1191
  Novus Biologicals Inc.

KIAA1191 overexpression lysate

KIAA1191 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

KIAA1191 overexpression lysate

KIAA1191 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn