TA335930 TMTC4 antibody

Rabbit Polyclonal Anti-TMTC4 Antibody

See related secondary antibodies

Search for all "TMTC4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat TMTC4

Product Description for TMTC4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rat TMTC4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMTC4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transmembrane and TPR repeat-containing protein 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T4D3
Immunogen:
The immunogen for Anti-TMTC4 Antibody: synthetic peptide directed towards the C terminal of human TMTC4. Synthetic peptide located within the following region: NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW.
GeneID:
84899
Application WB
Background It belongs to the TMTC family. Its exact function remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMTC4 (2 products)

Catalog No. Species Pres. Purity   Source  

TMTC4

TMTC4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TMTC4

TMTC4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn