TA335931 SDK1 antibody

Rabbit Polyclonal Anti-SDK1 Antibody

See related secondary antibodies

Search for all "SDK1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Rabbit, Zebrafish SDK1

Product Description for SDK1

Rabbit anti Bovine, Canine, Guinea Pig, Human, Rabbit, Zebrafish SDK1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SDK1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein sidekick-1
Presentation Purified
Reactivity Bov, Can, GP, Hu, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z5N4
Immunogen:
The immunogen for Anti-SDK1 Antibody: synthetic peptide directed towards the middle region of human SDK1. Synthetic peptide located within the following region: AVNEAGYGEPSNPSTAVSAQVEAPFYEEWWFLLVMALSSLIVILLVVFAL.
GeneID:
221935
Application WB
Background SDK1 is a cell adhesion protein that guides axol termils to specific sypses in developing neurons. Dysregulation of this protein may play an important role in podocyte dysfunction in HIV-associated nephropathy.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn