TA335943 SPPL2B antibody

Rabbit Polyclonal Anti-SPPL2B Antibody

See related secondary antibodies

Search for all "SPPL2B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat SPPL2B

TA335943

More Views

  • TA335943

Product Description for SPPL2B

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat SPPL2B.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SPPL2B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IMP-4, IMP4, Intramembrane protease 4, KIAA1532, PSL1, Presenilin-like protein 1, SPP-like 2B, Signal peptide peptidase-like 2B
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TCT7
Immunogen:
The immunogen for Anti-SPPL2B Antibody: synthetic peptide directed towards the N terminal of human SPPL2B. Synthetic peptide located within the following region: VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL.
GeneID:
56928
Application WB
IHC
Background SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the inte and adaptive immunity pathways.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SPPL2B (1 products)

Catalog No. Species Pres. Purity   Source  

Signal peptide peptidase-like 2B Lysate

Western Blot: Signal peptide peptidase-like 2B Lysate [NBL1-16426] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SPPL2B
  Novus Biologicals Inc.
  • LinkedIn