TA335947 ALS2CR4 / TMEM237 antibody

Rabbit Polyclonal Anti-ALS2CR4 Antibody

See related secondary antibodies

Search for all "ALS2CR4 / TMEM237"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ALS2CR4 / TMEM237

Product Description for ALS2CR4 / TMEM237

Rabbit anti Human ALS2CR4 / TMEM237.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ALS2CR4 / TMEM237

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein, Transmembrane protein 237
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96Q45
Immunogen:
Synthetic peptide directed towards the middle region of human ALS2CR4
AA Sequence:
AGDQLSNLSNLLQQYKTLAYPFQSLLYLLLALSTISAFDRIDFAKISVAI
GeneID:
65062
Application Western blotting (0.2 - 1.0 µg/ml)
Background TMEM237 or ALS2CR4 is a component of the transition zone in primary cilia and required for ciliogenesis. Defects in TMEM237 are the cause of Joubert syndrome type 14 (JBTS14). An autosomal recessive disorder characterized by severe mental retardation, hypotonia, breathing abnormalities in infancy, and dysmorphic facial features. Neuroradiologically, it is characterized by cerebellar vermian hypoplasia/aplasia, thickened and reoriented superior cerebellar peduncles, and an abnormally large interpeduncular fossa, giving the appearance of a molar tooth on transaxial slices (molar tooth sign). Additional variable JBTS14 features include renal disease, abnormal eye movements, and postaxial polydactyly.
General Readings "TMEM237 is mutated in individuals with a Joubert syndrome related disorder and expands the role of the TMEM family at the ciliary transition zone." Huang L., Szymanska K., Jensen V.L., Janecke A.R., Innes A.M., Davis E.E., Frosk P., Li C., Willer J.R., Chodirker B.N., Greenberg C.R., McLeod D.R., Bernier F.P., Chudley A.E., Muller T., Shboul M., Logan C.V., Loucks C.M. expand/collapse author list Boycott K.M. Am. J. Hum. Genet. 89:713-730(2011)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Positive controls for ALS2CR4 / TMEM237 (3 products)

Catalog No. Species Pres. Purity   Source  

ALS2CR4 Lysate

Western Blot: ALS2CR4 Lysate [NBL1-07491] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ALS2CR4 Protein
  Novus Biologicals Inc.

TMEM237 overexpression lysate

TMEM237 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TMEM237 overexpression lysate

TMEM237 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn