TA335951 TMEM91 antibody

Rabbit Polyclonal Anti-TMEM91 Antibody

See related secondary antibodies

Search for all "TMEM91"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Porcine TMEM91

Product Description for TMEM91

Rabbit anti Equine, Human, Porcine TMEM91.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM91

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DSPC3, Dispanin subfamily C member 3, Transmembrane protein 91
Presentation Purified
Reactivity Eq, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZNR0
Immunogen:
The immunogen for Anti-TMEM91 Antibody: synthetic peptide directed towards the N terminal of human TMEM91. Synthetic peptide located within the following region: SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV.
GeneID:
641649
Application WB
Background The function remains unknown.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TMEM91 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM91 (transcript variant 1)

TMEM91 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TMEM91 (1 products)

Catalog No. Species Pres. Purity   Source  

TMEM91 overexpression lysate

TMEM91 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn