TA335957 ABHD12 antibody

Rabbit Polyclonal Anti-ABHD12 Antibody

See related secondary antibodies

Search for all "ABHD12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat ABHD12

Product Description for ABHD12

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat ABHD12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ABHD12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Abhydrolase domain-containing protein 12, C20orf22
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N2K0
Immunogen:
The immunogen for Anti-ABHD12 Antibody: synthetic peptide directed towards the middle region of human ABHD12. Synthetic peptide located within the following region: CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH.
GeneID:
26090
Application WB
Background ABHD12 has 2-arachidonoylglycerol hydrolase activity.ABHD12 may be a regulator of endocanbinoid sigling pathways.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ABHD12 (4 products)

Catalog No. Species Pres. Purity   Source  

ABHD12 (transcript variant 1)

ABHD12 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ABHD12

ABHD12 Human
  Abnova Taiwan Corp.

ABHD12

ABHD12 Human Purified
  Abnova Taiwan Corp.

ABHD12

ABHD12 Human Purified
  Abnova Taiwan Corp.

Positive controls for ABHD12 (3 products)

Catalog No. Species Pres. Purity   Source  

ABHD12 293T Cell Transient Overexpression Lysate(Denatured)

ABHD12 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ABHD12 overexpression lysate

ABHD12 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ABHD12 overexpression lysate

ABHD12 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn