TA335966 CCDC112 antibody

Rabbit Polyclonal Anti-MGC39633 Antibody

See related secondary antibodies

Search for all "CCDC112"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat CCDC112

TA335966

More Views

  • TA335966

Product Description for CCDC112

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat CCDC112.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CCDC112

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Coiled-coil domain-containing protein 112, MBC1, MGC39633, Mutated in bladder cancer protein 1
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NEF3
Immunogen:
The immunogen for Anti-MGC39633 Antibody: synthetic peptide directed towards the N terminal of human MGC39633. Synthetic peptide located within the following region: VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE.
GeneID:
153733
Application WB
IHC
Background The function remains unknown.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CCDC112 (3 products)

Catalog No. Species Pres. Purity   Source  

CCDC112 (full length, N-term HIS tag, transcript variant 2)

CCDC112 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

CCDC112

CCDC112 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCDC112

CCDC112 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CCDC112 (3 products)

Catalog No. Species Pres. Purity   Source  

CCDC112 293T Cell Transient Overexpression Lysate(Denatured)

CCDC112 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CCDC112 Lysate

Western Blot: CCDC112 Lysate [NBL1-08768] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CCDC112
  Novus Biologicals Inc.

CCDC112 overexpression lysate

CCDC112 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn