TA335967 FAM63A antibody

Rabbit Polyclonal Anti-FAM63A Antibody

See related secondary antibodies

Search for all "FAM63A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat FAM63A

Product Description for FAM63A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat FAM63A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM63A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1390
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N5J2
Immunogen:
The immunogen for Anti-FAM63A Antibody: synthetic peptide directed towards the middle region of human FAM63A. Synthetic peptide located within the following region: LQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCIL.
GeneID:
55793
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM63A (4 products)

Catalog No. Species Pres. Purity   Source  

FAM63A (transcript variant 1)

FAM63A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FAM63A (transcript variant 3)

FAM63A Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FAM63A

FAM63A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FAM63A

FAM63A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FAM63A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM63A overexpression lysate

FAM63A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn