TA335968 CLDND1 antibody

Rabbit Polyclonal Anti-CLDND1 Antibody

See related secondary antibodies

Search for all "CLDND1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat CLDND1

Product Description for CLDND1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat CLDND1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CLDND1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C3orf4, Claudin domain-containing protein 1, GENX-3745, HSPC174, PRO6000, PSEC0054, UNQ2511
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NY35
Immunogen:
The immunogen for Anti-CLDND1 Antibody: synthetic peptide directed towards the middle region of human CLDND1. Synthetic peptide located within the following region: TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL.
GeneID:
56650
Application WB
Background CLDND1 belongs to the PMP-22/EMP/MP20 family. It is a multi-pass membrane proteinPotential. The exact function of CLDND1 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CLDND1 (1 products)

Catalog No. Species Pres. Purity   Source  

CLDND1 (transcript variant 2)

CLDND1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for CLDND1 (10 products)

Catalog No. Species Pres. Purity   Source  

CLDND1 Lysate

Western Blot: CLDND1 Lysate [NBL1-09252] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CLDND1
  Novus Biologicals Inc.

CLDND1 Lysate

Western Blot: CLDND1 Lysate [NBL1-09253] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CLDND1
  Novus Biologicals Inc.

CLDND1 overexpression lysate

CLDND1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CLDND1 overexpression lysate

CLDND1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CLDND1 overexpression lysate

CLDND1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CLDND1 overexpression lysate

CLDND1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CLDND1 overexpression lysate

CLDND1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CLDND1 overexpression lysate

CLDND1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

CLDND1 overexpression lysate

CLDND1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

CLDND1 overexpression lysate

CLDND1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn