TA335969 LFNG antibody

Rabbit Polyclonal Anti-LFNG Antibody

See related secondary antibodies

Search for all "LFNG"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Yeast LFNG

Product Description for LFNG

Rabbit anti Equine, Guinea Pig, Human, Mouse, Porcine, Rat, Yeast LFNG.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LFNG

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 3-N-acetylglucosaminyltransferase lunatic fringe, Beta-1, EC=2.4.1.222, LFNG, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Presentation Purified
Reactivity Eq, GP, Hu, Ms, Por, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NES3
Immunogen:
The immunogen for Anti-LFNG Antibody: synthetic peptide directed towards the N terminal of human LFNG. Synthetic peptide located within the following region: LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK.
GeneID:
3955
Application WB
Background LFNG is a member of the glycosyltransferase superfamily. It is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of sigling receptors involved in regulating cell fate decisions during development. Mutations in the gene that encodes this protein have been associated with autosomal recessive spondylocostal dysostosis 3. This gene encodes a member of the glycosyltransferase superfamily. The encoded protein is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of sigling receptors involved in regulating cell fate decisions during development. Mutations in this gene have been associated with autosomal recessive spondylocostal dysostosis 3. Altertively spliced transcript variants that encode different isoforms have been described, however, not all variants have been fully characterized.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LFNG (2 products)

Catalog No. Species Pres. Purity   Source  

LFNG

LFNG Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LFNG

LFNG Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for LFNG (4 products)

Catalog No. Species Pres. Purity   Source  

LFNG Lysate(Denatured)

LFNG Lysate(Denatured)
  Abnova Taiwan Corp.

LFNG overexpression lysate

LFNG overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

LFNG overexpression lysate

LFNG overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

LFNG overexpression lysate

LFNG overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn