TA335974 MOSPD3 antibody

Rabbit Polyclonal Anti-MOSPD3 Antibody

See related secondary antibodies

Search for all "MOSPD3"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat MOSPD3

TA335974

More Views

  • TA335974

Product Description for MOSPD3

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat MOSPD3.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for MOSPD3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Motile sperm domain-containing protein 3
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75425
Immunogen:
The immunogen for Anti-MOSPD3 Antibody: synthetic peptide directed towards the C terminal of human MOSPD3. Synthetic peptide located within the following region: FLLFLLTGIVSVAFLLLPLPDELGSQLPQVLHVSLGQKLVAAYVLGLLTM.
GeneID:
64598
Application WB
IHC
Background MOSPD3 is a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neotal lethality.This gene encodes a multi-pass membrane protein with a major sperm protein (MSP) domain. The deletion of a similar mouse gene is associated with defective cardiac development and neotal lethality. Alterte transcriptiol splice variants, encoding different isoforms, have been described.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MOSPD3 (5 products)

Catalog No. Species Pres. Purity   Source  

MOSPD3 (transcript variant 1)

MOSPD3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MOSPD3

MOSPD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MOSPD3

MOSPD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MOSPD3

MOSPD3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MOSPD3

MOSPD3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MOSPD3 (7 products)

Catalog No. Species Pres. Purity   Source  

MOSPD3 293T Cell Transient Overexpression Lysate(Denatured)

MOSPD3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MOSPD3 Lysate

Western Blot: MOSPD3 Lysate [NBL1-13193] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for MOSPD3.
  Novus Biologicals Inc.

MOSPD3 overexpression lysate

MOSPD3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

MOSPD3 overexpression lysate

MOSPD3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

MOSPD3 overexpression lysate

MOSPD3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

MOSPD3 overexpression lysate

MOSPD3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

MOSPD3 overexpression lysate

MOSPD3 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn