TA335986 OLAH / THEDC1 antibody

Rabbit Polyclonal Anti-OLAH Antibody

See related secondary antibodies

Search for all "OLAH / THEDC1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Mouse OLAH / THEDC1

Product Description for OLAH / THEDC1

Rabbit anti Equine, Human, Mouse OLAH / THEDC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OLAH / THEDC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AURA1, Augmented in rheumatoid arthritis 1, Oleoyl-ACP hydrolase, S-acyl fatty acid synthase thioesterase medium chain, Thioesterase II, Thioesterase domain-containing protein 1
Presentation Purified
Reactivity Eq, Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NV23
Immunogen:
The immunogen for Anti-OLAH Antibody: synthetic peptide directed towards the N terminal of human OLAH. Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC.
GeneID:
55301
Application WB
Background OLAH plays a role in fatty acid biosynthesis chain termition and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for OLAH / THEDC1 (1 products)

Catalog No. Species Pres. Purity   Source  

OLAH / THEDC1 (transcript variant 2)

OLAH / THEDC1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for OLAH / THEDC1 (4 products)

Catalog No. Species Pres. Purity   Source  

OLAH Lysate

Western Blot: OLAH Lysate [NBL1-13924]
  Novus Biologicals Inc.

OLAH overexpression lysate

OLAH overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

OLAH overexpression lysate

OLAH overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

OLAH overexpression lysate

OLAH overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn