TA335990 ZDHHC19 antibody

Rabbit Polyclonal Anti-ZDHHC19 Antibody

See related secondary antibodies

Search for all "ZDHHC19"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Porcine ZDHHC19

Product Description for ZDHHC19

Rabbit anti Human, Porcine ZDHHC19.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZDHHC19

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DHHC-19, Probable palmitoyltransferase ZDHHC19, Zinc finger DHHC domain-containing protein 19
Presentation Purified
Reactivity Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WVZ1
Immunogen:
The immunogen for Anti-ZDHHC19 Antibody: synthetic peptide directed towards the N terminal of human ZDHHC19. Synthetic peptide located within the following region: TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR.
GeneID:
131540
Application WB
Background ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. ZDHHC19 is a multi-pass membrane protein. The function of the ZDHHC19 protein is not known.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZDHHC19 (2 products)

Catalog No. Species Pres. Purity   Source  

ZDHHC19

ZDHHC19 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZDHHC19

ZDHHC19 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZDHHC19 (2 products)

Catalog No. Species Pres. Purity   Source  

ZDHHC19 293T Cell Transient Overexpression Lysate(Denatured)

ZDHHC19 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZDHHC19 overexpression lysate

ZDHHC19 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn