TA335992 Kremen protein 1 antibody

Rabbit Polyclonal Anti-KREMEN1 Antibody

See related secondary antibodies

Search for all "Kremen protein 1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Kremen protein 1

Product Description for Kremen protein 1

Rabbit anti Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Kremen protein 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Kremen protein 1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Dickkopf receptor, KREMEN, KREMEN1, KRM1, Kringle domain-containing transmembrane protein 1, Kringle-containing protein marking the eye and the nose
Presentation Purified
Reactivity Can, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96MU8
Immunogen:
The immunogen for Anti-KREMEN1 Antibody: synthetic peptide directed towards the N terminal of human KREMEN1. Synthetic peptide located within the following region: LKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG.
GeneID:
83999
Application WB
Background KREMEN1 is a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functiolly cooperates with DKK1 to block wingless (WNT)/beta-catenin sigling. It is a component of a membrane complex that modulates canonical WNT sigling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functiolly cooperates with DKK1 to block wingless (WNT)/beta-catenin sigling. The encoded protein is a component of a membrane complex that modulates canonical WNT sigling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Altertively spliced transcript variants encoding distinct isoforms have been observed for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Kremen protein 1 (4 products)

Catalog No. Species Pres. Purity   Source  

Kremen protein 1

Kremen protein 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Kremen protein 1

Kremen protein 1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Kremen protein 1

Kremen protein 1 Human
  Abnova Taiwan Corp.

Kremen protein 1

Kremen protein 1 Human
  Abnova Taiwan Corp.

Positive controls for Kremen protein 1 (1 products)

Catalog No. Species Pres. Purity   Source  

KREMEN1 overexpression lysate

KREMEN1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn