TA335997 C9orf68 antibody

Rabbit Polyclonal Anti-C9orf68 Antibody

See related secondary antibodies

Search for all "C9orf68"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C9orf68

Product Description for C9orf68

Rabbit anti Human C9orf68.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C9orf68

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uncharacterized protein C9orf68, chromosome 9 open reading frame 68
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N4H0
Immunogen:
The immunogen for Anti-C9orf68 Antibody: synthetic peptide directed towards the middle region of human C9orf68. Synthetic peptide located within the following region: CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG.
GeneID:
55064
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C9orf68 (2 products)

Catalog No. Species Pres. Purity   Source  

C9orf68 293T Cell Transient Overexpression Lysate(Denatured)

C9orf68 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SPATA6L overexpression lysate

SPATA6L overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn