TA335998 HEPACAM2 antibody

Rabbit Polyclonal Anti-Hepacam2 Antibody

See related secondary antibodies

Search for all "HEPACAM2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat HEPACAM2

Product Description for HEPACAM2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat HEPACAM2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HEPACAM2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HEPACAM family member 2, LOC253012
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A8MVW5
Immunogen:
The immunogen for Anti-Hepacam2 Antibody is: synthetic peptide directed towards the N-terminal region of Rat Hepacam2. Synthetic peptide located within the following region: VTVPSHTVHGIRGQALYLPVHYGFHTPASDIQIIWLFERSHTTPKYLLGS.
GeneID:
253012
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HEPACAM2 (3 products)

Catalog No. Species Pres. Purity   Source  

HEPACAM2 (transcript variant 1)

HEPACAM2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

HEPACAM2 (32-351, His-tag)

HEPACAM2 Human Purified > 85 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

HEPACAM2 (32-351, His-tag)

HEPACAM2 Human Purified > 85 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

Positive controls for HEPACAM2 (1 products)

Catalog No. Species Pres. Purity   Source  

HEPACAM2 overexpression lysate

HEPACAM2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn