TA336004 ARL17B antibody

Rabbit Polyclonal Anti-ARL17 Antibody

See related secondary antibodies

Search for all "ARL17B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ARL17B

Product Description for ARL17B

Rabbit anti Human ARL17B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARL17B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADP-ribosylation factor 7 variant, ADP-ribosylation factor-like protein 17, ARL17A, ARL17P1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IVW1
Immunogen:
The immunogen for Anti-ARL17 Antibody: synthetic peptide directed towards the middle region of human ARL17. Synthetic peptide located within the following region: KCSHVEFGMWKGGRSHPFLPHSSRCAGSGGQLDSILPHQSPAWGPWGCKD.
GeneID:
100506084
Application WB
Background ARL17 is a GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. ARL17 is involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ARL17B (1 products)

Catalog No. Species Pres. Purity   Source  

ARL17A overexpression lysate

ARL17A overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn