TA336020 C18orf32 antibody

Rabbit Polyclonal Anti-C18orf32 Antibody

See related secondary antibodies

Search for all "C18orf32"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C18orf32

Product Description for C18orf32

Rabbit anti Human C18orf32.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C18orf32

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Putative NF-kappa-B-activating protein 200, UPF0729 protein C18orf32
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TCD1
Immunogen:
The immunogen for Anti-C18orf32 Antibody: synthetic peptide directed towards the middle region of human C18orf32. Synthetic peptide located within the following region: PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK.
GeneID:
497661
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C18orf32 (1 products)

Catalog No. Species Pres. Purity   Source  

C18orf32

C18orf32 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C18orf32 (2 products)

Catalog No. Species Pres. Purity   Source  

C18orf32 Lysate

Western Blot: C18orf32 Lysate [NBL1-08254] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C18orf32 Protein
  Novus Biologicals Inc.

C18orf32 overexpression lysate

C18orf32 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn