TA336026 MAWBP antibody

Rabbit Polyclonal Anti-PBLD Antibody

See related secondary antibodies

Search for all "MAWBP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse MAWBP

Product Description for MAWBP

Rabbit anti Bovine, Canine, Human, Mouse MAWBP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MAWBP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PBLD, Phenazine biosynthesis-like domain-containing protein, Unknown protein 32 from 2D-page of liver tissue
Presentation Purified
Reactivity Bov, Can, Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P30039
Immunogen:
The immunogen for Anti-PBLD Antibody: synthetic peptide directed towards the N terminal of human PBLD. Synthetic peptide located within the following region: KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR.
GeneID:
64081
Application WB
Background The function of the PBLD protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MAWBP (8 products)

Catalog No. Species Pres. Purity   Source  

MAWBP (transcript variant 1)

MAWBP Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MAWBP (transcript variant 1)

MAWBP Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

MAWBP (1-288, His-tag)

MAWBP Human Purified > 95 % E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

MAWBP (1-288, His-tag)

MAWBP Human Purified > 95 % E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

MAWBP

MAWBP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MAWBP

MAWBP Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

MAWBP

MAWBP Human Purified
  Novus Biologicals Inc.

MAWBP

MAWBP Human Purified
  Novus Biologicals Inc.

Positive controls for MAWBP (2 products)

Catalog No. Species Pres. Purity   Source  

MAWBP 293T Cell Transient Overexpression Lysate(Denatured)

MAWBP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PBLD Lysate

Western Blot: PBLD Lysate [NBL1-14136] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PBLD
  Novus Biologicals Inc.
  • LinkedIn