TA336032 C1orf151 antibody

Rabbit Polyclonal Anti-C1orf151 Antibody

See related secondary antibodies

Search for all "C1orf151"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat C1orf151

Product Description for C1orf151

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat C1orf151.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C1orf151

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms UPF0327 protein C1orf151
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5TGZ0
Immunogen:
The immunogen for Anti-C1orf151 Antibody: synthetic peptide directed towards the middle region of human C1orf151. Synthetic peptide located within the following region: IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ.
GeneID:
440574
Application WB
Background The exact function of C1orf151 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C1orf151 (1 products)

Catalog No. Species Pres. Purity   Source  

C1orf151

C1orf151 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C1orf151 (1 products)

Catalog No. Species Pres. Purity   Source  

MINOS1 overexpression lysate

MINOS1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn