TA336036 CPT1A / CPT1-L antibody

Rabbit Polyclonal Anti-CPT1A Antibody

See related secondary antibodies

Search for all "CPT1A / CPT1-L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish CPT1A / CPT1-L

TA336036

More Views

  • TA336036
  • TA336036
  • TA336036

Product Description for CPT1A / CPT1-L

Rabbit anti Canine, Equine, Human, Porcine, Rabbit, Rat, Zebrafish CPT1A / CPT1-L.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for CPT1A / CPT1-L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Carnitine O-palmitoyltransferase 1 liver isoform, Carnitine palmitoyltransferase 1A
Presentation Purified
Reactivity Can, Eq, Hu, Por, Rb, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P50416
Immunogen:
The immunogen for Anti-CPT1A Antibody: synthetic peptide directed towards the middle region of human CPT1A. Synthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN.
GeneID:
1374
Application IHC
WB
Background The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Altertively spliced transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CPT1A / CPT1-L (7 products)

Catalog No. Species Pres. Purity   Source  

CPT1A / CPT1-L (transcript variant 1)

CPT1A / CPT1-L Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CPT1A / CPT1-L

CPT1A / CPT1-L Human Purified
  Abnova Taiwan Corp.

CPT1A / CPT1-L

CPT1A / CPT1-L Human
  Abnova Taiwan Corp.

CPT1A / CPT1-L

CPT1A / CPT1-L Human Purified
  Abnova Taiwan Corp.

CPT1A / CPT1-L

CPT1A / CPT1-L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CPT1A / CPT1-L

CPT1A / CPT1-L Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CPT1A / CPT1-L

CPT1A / CPT1-L Human
  Abnova Taiwan Corp.

Positive controls for CPT1A / CPT1-L (3 products)

Catalog No. Species Pres. Purity   Source  

CPT1A 293T Cell Transient Overexpression Lysate(Denatured)

CPT1A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CPT1A Lysate

Western Blot: CPT1A Lysate [NBL1-09449] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CPT1A
  Novus Biologicals Inc.

CPT1A overexpression lysate

CPT1A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn