TA336037 DNAJB14 antibody

Rabbit Polyclonal Anti-DNAJB14 Antibody

See related secondary antibodies

Search for all "DNAJB14"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat DNAJB14

Product Description for DNAJB14

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat DNAJB14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DNAJB14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DnaJ homolog subfamily B member 14
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TBM8
Immunogen:
The immunogen for Anti-DNAJB14 Antibody is: synthetic peptide directed towards the N-terminal region of Human DNAJB14. Synthetic peptide located within the following region: SGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKD.
GeneID:
79982
Application WB
Background DJB14 may act as a co-chaperone.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DNAJB14 (2 products)

Catalog No. Species Pres. Purity   Source  

DNAJB14

DNAJB14 Human Purified
  Abnova Taiwan Corp.

DNAJB14

DNAJB14 Human Purified
  Abnova Taiwan Corp.

Positive controls for DNAJB14 (2 products)

Catalog No. Species Pres. Purity   Source  

DNAJB14 Lysate

Western Blot: DNAJB14 Lysate [NBL1-09935] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DNAJB14
  Novus Biologicals Inc.

DNAJB14 overexpression lysate

DNAJB14 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn