TA336040 PLD3 antibody

Rabbit Polyclonal Anti-PLD3 Antibody

See related secondary antibodies

Search for all "PLD3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PLD3

TA336040

More Views

  • TA336040

Product Description for PLD3

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PLD3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PLD3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Choline phosphatase 3, Hu-K4, PLD 3, Phosphatidylcholine-hydrolyzing phospholipase D3, Phospholipase D3
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IV08
Immunogen:
The immunogen for Anti-PLD3 Antibody: synthetic peptide directed towards the N terminal of human PLD3. Synthetic peptide located within the following region: WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE.
GeneID:
23646
Application WB
Background PLD3 is a ingle-pass type II membrane protein. It belongs to the phospholipase D family. PLD3 contains 2 PLD phosphodiesterase domains. The exact function of PLD3 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PLD3 (3 products)

Catalog No. Species Pres. Purity   Source  

PLD3 (transcript variant 1)

PLD3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PLD3

PLD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PLD3

PLD3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for PLD3 (1 products)

Catalog No. Species Pres. Purity   Source  

PLD3 Lysate

Western Blot: PLD3/Phospholipase D3 Lysate [NBL1-14495] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for PLD3.
  Novus Biologicals Inc.
  • LinkedIn