TA336043 CYB5RL antibody

Rabbit Polyclonal Anti-CYB5RL Antibody

See related secondary antibodies

Search for all "CYB5RL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat CYB5RL

Product Description for CYB5RL

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat CYB5RL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CYB5RL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NADH-cytochrome b5 reductase-like
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IPT4
Immunogen:
The immunogen for Anti-CYB5RL Antibody: synthetic peptide directed towards the N terminal of human LOC606495. Synthetic peptide located within the following region: KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD.
GeneID:
606495
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CYB5RL (1 products)

Catalog No. Species Pres. Purity   Source  

CYB5RL overexpression lysate

CYB5RL overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn