TA336044 RPS15A antibody

Rabbit Polyclonal Anti-RPS15A Antibody

See related secondary antibodies

Search for all "RPS15A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Goat, Human, Mouse, Rabbit, Zebrafish RPS15A

Product Description for RPS15A

Rabbit anti Goat, Human, Mouse, Rabbit, Zebrafish RPS15A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPS15A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 40S ribosomal protein S15a
Presentation Purified
Reactivity Gt, Hu, Ms, Rb, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P62244
Immunogen:
The immunogen for Anti-RPS15A Antibody: synthetic peptide directed towards the middle region of human RPS15A. Synthetic peptide located within the following region: KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH.
GeneID:
6210
Application WB
Background The specific function of this protein remains unknown.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 R species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S8P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RPS15A (5 products)

Catalog No. Species Pres. Purity   Source  

RPS15A (full length, N-term HIS tag, transcript variant 2)

RPS15A Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

RPS15A

RPS15A Human Purified
  Abnova Taiwan Corp.

RPS15A

RPS15A Human Purified
  Abnova Taiwan Corp.

RPS15A

RPS15A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPS15A

RPS15A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for RPS15A (1 products)

Catalog No. Species Pres. Purity   Source  

RPS15A Lysate

Western Blot: RPS15A Lysate [NBL1-15560] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RPS15A
  Novus Biologicals Inc.
  • LinkedIn