TA336049 Anoctamin-6 antibody

Rabbit Polyclonal Anti-ANO6 Antibody

See related secondary antibodies

Search for all "Anoctamin-6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat Anoctamin-6

Product Description for Anoctamin-6

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat Anoctamin-6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Anoctamin-6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ANO6, TMEM16F, Transmembrane protein 16F
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4KMQ2
Immunogen:
The immunogen for Anti-ANO6 Antibody: synthetic peptide directed towards the C-terminal region of human ANO6. Synthetic peptide located within the following region: KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV.
GeneID:
196527
Application WB
Background TMEM16F may act as a calcium-activated chloride channel.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Anoctamin-6 (2 products)

Catalog No. Species Pres. Purity   Source  

Anoctamin-6

Anoctamin-6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Anoctamin-6

Anoctamin-6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn