TA336080 IGSF11 / BTIGSF antibody

Rabbit Polyclonal Anti-IGSF11 Antibody

See related secondary antibodies

Search for all "IGSF11 / BTIGSF"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit IGSF11 / BTIGSF

Product Description for IGSF11 / BTIGSF

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit IGSF11 / BTIGSF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for IGSF11 / BTIGSF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Brain and testis-specific immunoglobulin superfamily protein, CXADRL1, Immunoglobulin superfamily member 11, V-set and immunoglobulin domain-containing protein 3, VSIG3
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5DX21
Immunogen:
The immunogen for Anti-IGSF11 Antibody: synthetic peptide directed towards the middle region of human IGSF11. Synthetic peptide located within the following region: EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL.
GeneID:
152404
Application WB
Background IGSF11 functions as a cell adhesion molecule through homophilic interaction. IGSF11 stimulates cell growth.IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).[supplied by OMIM].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for IGSF11 / BTIGSF (5 products)

Catalog No. Species Pres. Purity   Source  

IGSF11 / BTIGSF (transcript variant 1)

IGSF11 / BTIGSF Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

IGSF11 / BTIGSF

IGSF11 / BTIGSF Human in vitro transl.
  Abnova Taiwan Corp.

IGSF11 / BTIGSF

IGSF11 / BTIGSF Human in vitro transl.
  Abnova Taiwan Corp.

IGSF11 / BTIGSF

IGSF11 / BTIGSF Human in vitro transl.
  Abnova Taiwan Corp.

IGSF11 / BTIGSF

IGSF11 / BTIGSF Human Purified
  Novus Biologicals Inc.

Positive controls for IGSF11 / BTIGSF (2 products)

Catalog No. Species Pres. Purity   Source  

IGSF11 Lysate

Western Blot: IGSF11 Lysate [NBL1-11882] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for IGSF11
  Novus Biologicals Inc.

IGSF11 overexpression lysate

IGSF11 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn