TA336114 CLEC18B antibody

Rabbit Polyclonal Anti-CLEC18B Antibody

See related secondary antibodies

Search for all "CLEC18B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat CLEC18B

Product Description for CLEC18B

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat CLEC18B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CLEC18B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C-type lectin domain family 18 member B, MRLP1, Mannose receptor-like protein 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UXF7
Immunogen:
The immunogen for Anti-CLEC18B Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC18B. Synthetic peptide located within the following region: DLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGR.
GeneID:
497190
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CLEC18B (1 products)

Catalog No. Species Pres. Purity   Source  

CLEC18B overexpression lysate

CLEC18B overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn