TA336120 GLT8D1 antibody

Rabbit Polyclonal Anti-GLT8D1 Antibody

See related secondary antibodies

Search for all "GLT8D1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit GLT8D1

Product Description for GLT8D1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit GLT8D1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GLT8D1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GALA4A, Glycosyltransferase 8 domain-containing protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q68CQ7
Immunogen:
The immunogen for Anti-GLT8D1 Antibody: synthetic peptide directed towards the middle region of human GLT8D1. Synthetic peptide located within the following region: LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWG.
GeneID:
55830
Application WB
Background GLT8D1 is a member of the glycosyltransferase family. The specific function of this protein has not been determined. Three altertively spliced variants encoding the same isoform have been described.This gene encodes a member of the glycosyltransferase family. The specific function of this protein has not been determined. Three altertively spliced variants encoding the same isoform have been described.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn