TA336143 TPST2 antibody

Rabbit Polyclonal Anti-TPST2 Antibody

See related secondary antibodies

Search for all "TPST2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TPST2

Product Description for TPST2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat TPST2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TPST2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein-tyrosine sulfotransferase 2, TPST-2, Tyrosylprotein sulfotransferase-2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60704
Immunogen:
The immunogen for Anti-TPST2 Antibody: synthetic peptide directed towards the middle region of human TPST2. Synthetic peptide located within the following region: KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL.
GeneID:
8459
Application WB
Background TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TPST2 (6 products)

Catalog No. Species Pres. Purity   Source  

TPST2 (transcript variant 1)

TPST2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TPST2 (26-377, His-tag)

TPST2 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

TPST2 (26-377, His-tag)

TPST2 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

TPST2 (26-377, His-tag)

TPST2 Human Purified > 95 % by SDS - PAGE
0.25 mg / €1,070.00
  OriGene Technologies GmbH

TPST2 (26-377, His-tag)

TPST2 Human Purified > 95 % by SDS - PAGE
50 µg / €320.00
  OriGene Technologies GmbH

TPST2

TPST2 Human
  Abnova Taiwan Corp.

Positive controls for TPST2 (1 products)

Catalog No. Species Pres. Purity   Source  

TPST2 Lysate

Western Blot: TPST2 Lysate [NBL1-17233] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TPST2
  Novus Biologicals Inc.
  • LinkedIn