TA336152 GP2 / ZAP75 antibody

Rabbit Polyclonal Anti-GP2 Antibody

See related secondary antibodies

Search for all "GP2 / ZAP75"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat GP2 / ZAP75

TA336152

More Views

  • TA336152
  • TA336152
  • TA336152

Product Description for GP2 / ZAP75

Rabbit anti Bovine, Equine, Human, Mouse, Porcine, Rat GP2 / ZAP75.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GP2 / ZAP75

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GP-2, Pancreatic secretory granule membrane major glycoprotein GP2, Pancreatic zymogen granule membrane protein GP-2
Presentation Purified
Reactivity Bov, Eq, Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P55259
Immunogen:
The immunogen for Anti-GP2 Antibody: synthetic peptide directed towards the middle region of human GP2. Synthetic peptide located within the following region: SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES.
GeneID:
2813
Application WB
IHC
Background GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for GP2 / ZAP75 (1 products)

Catalog No. Species Pres. Purity   Source  

GP2 Lysate

Western Blot: GP2 Lysate [NBL1-11210] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GP2
  Novus Biologicals Inc.
  • LinkedIn