TA336162 RPS3A antibody

Rabbit Polyclonal Anti-RPS3A Antibody

See related secondary antibodies

Search for all "RPS3A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Zebrafish RPS3A

TA336162

More Views

  • TA336162

Product Description for RPS3A

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Zebrafish RPS3A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPS3A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 40S ribosomal protein S3a, FTE1, Fte-1, MFTL, v-fos transformation effector protein
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P61247
Immunogen:
The immunogen for Anti-RPS3A Antibody: synthetic peptide directed towards the N terminal of human RPS3A. Synthetic peptide located within the following region: APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF.
GeneID:
6189
Application WB
Background RPS3A may play a role during erythropoiesis through regulation of transcription factor DDIT3.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 R species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S3AE family of ribosomal proteins. It is located in the cytoplasm. Disruption of the gene encoding rat ribosomal protein S3a, also med v-fos transformation effector protein, in v-fos-transformed rat cells results in reversion of the transformed phenotype. Transcript variants utilizing altertive transcription start sites have been described. This gene is co-transcribed with the U73A and U73B small nucleolar R genes, which are located in its fourth and third introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RPS3A (6 products)

Catalog No. Species Pres. Purity   Source  

RPS3A (1-264, His-tag)

RPS3A Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

RPS3A (1-264, His-tag)

RPS3A Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

RPS3A

RPS3A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPS3A

RPS3A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPS3A

RPS3A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RPS3A

RPS3A Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RPS3A (1 products)

Catalog No. Species Pres. Purity   Source  

RPS3A overexpression lysate

RPS3A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn