TA336176 LRRC52 antibody

Rabbit Polyclonal Anti-LRRC52 Antibody

See related secondary antibodies

Search for all "LRRC52"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LRRC52

Product Description for LRRC52

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat LRRC52.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LRRC52

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Leucine-rich repeat-containing protein 52
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N7C0
Immunogen:
The immunogen for Anti-LRRC52 Antibody: synthetic peptide directed towards the N terminal of human LRRC52. Synthetic peptide located within the following region: QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC.
GeneID:
440699
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for LRRC52 (1 products)

Catalog No. Species Pres. Purity   Source  

LRRC52 overexpression lysate

LRRC52 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn