TA336177 Olfactory receptor 2W5 antibody

Rabbit Polyclonal Anti-OR2W5 Antibody

See related secondary antibodies

Search for all "Olfactory receptor 2W5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Olfactory receptor 2W5

Product Description for Olfactory receptor 2W5

Rabbit anti Human Olfactory receptor 2W5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olfactory receptor 2W5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms OR2W5, OR2W5P
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NFC9
Immunogen:
The immunogen for Anti-OR2W5 Antibody: synthetic peptide directed towards the middle region of human OR2W5. Synthetic peptide located within the following region: SGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGT.
GeneID:
441932
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. This olfactory receptor gene has a coding sequence that is comparable in length to other olfactory receptor genes, but it should be noted that a frameshift is present in the 3' coding region that disrupts the 7-transmembrane domain structure in the protein. It is unclear if the protein can function as an olfactory receptor or if an alterte function is served. For this reason, this gene has also been interpreted to be a pseudogene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn