TA336186 C7orf61 antibody

Rabbit Polyclonal Anti-C7orf61 Antibody

See related secondary antibodies

Search for all "C7orf61"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C7orf61

Product Description for C7orf61

Rabbit anti Human C7orf61.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C7orf61

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LOC402573
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IZ16
Immunogen:
The immunogen for Anti-C7orf61 Antibody: synthetic peptide directed towards the C terminal of human LOC402573. Synthetic peptide located within the following region: YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL.
GeneID:
402573
Application WB
Background The exact function of LOC402573 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C7orf61 (1 products)

Catalog No. Species Pres. Purity   Source  

C7orf61

C7orf61 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C7orf61 (2 products)

Catalog No. Species Pres. Purity   Source  

C7orf61 Lysate

Western Blot: C7orf61 Lysate [NBL1-12606] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C7orf61
  Novus Biologicals Inc.

C7orf61 overexpression lysate

C7orf61 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn