TA336187 CCDC144NL antibody

Rabbit Polyclonal Anti-CCDC144NL Antibody

See related secondary antibodies

Search for all "CCDC144NL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CCDC144NL

Product Description for CCDC144NL

Rabbit anti Human CCDC144NL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CCDC144NL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Putative coiled-coil domain-containing protein 144 N-terminal-like
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NUI1
Immunogen:
The immunogen for Anti-CCDC144NL Antibody: synthetic peptide directed towards the middle region of human CCDC144NL. Synthetic peptide located within the following region: VDKRDRKKSIQQLVPEYKEKQTPESLPQNNNPAAPSQAEGGEGGVACGTV.
GeneID:
339184
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for CCDC144NL (2 products)

Catalog No. Species Pres. Purity   Source  

CCDC144NL Lysate

Western Blot: CCDC144NL Lysate [NBL1-13086] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CCDC144NL
  Novus Biologicals Inc.

CCDC144NL overexpression lysate

CCDC144NL overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn