TA336193 MYL4 antibody

Rabbit Polyclonal Anti-MYL4 Antibody

See related secondary antibodies

Search for all "MYL4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human MYL4

Product Description for MYL4

Rabbit anti Bovine, Canine, Human MYL4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MYL4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GT-1 isoform, MLC1, Myosin light chain 1, Myosin light chain 4, Myosin light chain alkali, PRO1957, embryonic muscle/atrial isoform
Presentation Purified
Reactivity Bov, Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P12829
Immunogen:
The immunogen for Anti-MYL4 Antibody: synthetic peptide directed towards the N terminal of human MYL4. Synthetic peptide located within the following region: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA.
GeneID:
4635
Application WB
Background Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two altertively spliced transcript variants encoding the same protein have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MYL4 (6 products)

Catalog No. Species Pres. Purity   Source  

MYL4 (transcript variant 1)

MYL4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MYL4 (transcript variant 2)

MYL4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

MYL4 (1-197, His-tag)

MYL4 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

MYL4 (1-197, His-tag)

MYL4 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

MYL4

MYL4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MYL4

MYL4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for MYL4 (5 products)

Catalog No. Species Pres. Purity   Source  

MYL4 293T Cell Transient Overexpression Lysate(Denatured)

MYL4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

MYL4 Lysate

Western Blot: MYL4 Lysate [NBL1-13426] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MYL4
  Novus Biologicals Inc.

MYL4 overexpression lysate

MYL4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

MYL4 overexpression lysate

MYL4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

MYL4 overexpression lysate

MYL4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn