TA336198 FAM116B antibody

Rabbit Polyclonal Anti-DENND6B Antibody

See related secondary antibodies

Search for all "FAM116B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat FAM116B

Product Description for FAM116B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat FAM116B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM116B

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NEG7
Immunogen:
The immunogen for Anti-DENND6B Antibody is: synthetic peptide directed towards the N-terminal region of Human DENND6B. Synthetic peptide located within the following region: PVALQREPAHYFGYVYFRQVKDSSVKRGYFQKSLVLVSRLPFVRLFQALL.
GeneID:
414918
Application WB
Background DENND6B is a Guanine nucleotide exchange factor (GEF) for RAB14. It also has some, lesser GEF activity towards RAB35.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM116B (3 products)

Catalog No. Species Pres. Purity   Source  

FAM116B

FAM116B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FAM116B

FAM116B Human Purified
  Abnova Taiwan Corp.

FAM116B

FAM116B Human Purified
  Abnova Taiwan Corp.

Positive controls for FAM116B (1 products)

Catalog No. Species Pres. Purity   Source  

DENND6B overexpression lysate

DENND6B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn