TA336200 FAM166A antibody

Rabbit Polyclonal Anti-FAM166A Antibody

See related secondary antibodies

Search for all "FAM166A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat FAM166A

Product Description for FAM166A

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat FAM166A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM166A

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6J272
Immunogen:
The immunogen for Anti-FAM166A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM166A. Synthetic peptide located within the following region: TTGQLLTDPSVQKSPCSVLSPMSKPKFIEDFSQSKPPRVPCQDLTEPYIP.
GeneID:
401565
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FAM166A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM166A

FAM166A Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for FAM166A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM166A overexpression lysate

FAM166A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn