TA336221 ALOX12 / LOG12 antibody

Rabbit Polyclonal Anti-ALOX12 Antibody

See related secondary antibodies

Search for all "ALOX12 / LOG12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ALOX12 / LOG12

Product Description for ALOX12 / LOG12

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ALOX12 / LOG12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ALOX12 / LOG12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 12-LOX, 12S-type, Arachidonate 12-lipoxygenase
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P18054
Immunogen:
The immunogen for Anti-ALOX12 Antibody: synthetic peptide directed towards the C terminal of human ALOX12. Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF.
GeneID:
239
Application WB
Background ALOX12 belongs to the lipoxygese family. It contains 1 lipoxygese domain and 1 PLAT domain. It has oxygese and 14,15-leukotriene A4 synthase activity.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ALOX12 / LOG12 (5 products)

Catalog No. Species Pres. Purity   Source  

ALOX12 / LOG12

ALOX12 / LOG12 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ALOX12 / LOG12

ALOX12 / LOG12 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALOX12 / LOG12

ALOX12 / LOG12 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ALOX12 / LOG12

ALOX12 / LOG12 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ALOX12 / LOG12

ALOX12 / LOG12 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ALOX12 / LOG12 (2 products)

Catalog No. Species Pres. Purity   Source  

ALOX12 / LOG12 Lysate(Denatured)

ALOX12 / LOG12 Lysate(Denatured)
  Abnova Taiwan Corp.

ALOX12 overexpression lysate

ALOX12 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn