CD213a2 / IL13RA2

Product Description for CD213a2 / IL13RA2

Rabbit anti Human, Rabbit, Rat CD213a2 / IL13RA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	IL-13R-alpha-2, IL-13RA-2, IL13 receptor alpha-2, IL13R, IL13RA2, Interleukin-13 receptor alpha-2 chain, Interleukin-13-binding protein
Presentation	Purified
Reactivity	Hu, Rb, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Immunogen	Swiss Prot Num: Q14627 Immunogen: The immunogen for Anti-IL13RA2 Antibody: synthetic peptide directed towards the middle region of human IL13RA2. Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP. GeneID: 3598
Application	WB
Background	IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a sigl mediator. It is reported to play a role in the interlization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a sigl mediator. It is reported to play a role in the interlization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format	Purification: Affinity Purified Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Catalog No.	Species	Pres.	Purity	Source
AR50963PU-N	CD213a2 / IL13RA2 (27-343, His-tag)
	Human	Purified	> 85 % by SDS - PAGE	E. coli	0.5 mg / €820.00
					OriGene Technologies GmbH
AR50963PU-S	CD213a2 / IL13RA2 (27-343, His-tag)
	Human	Purified	> 85 % by SDS - PAGE	E. coli	0.1 mg / €320.00
					OriGene Technologies GmbH
H00003598-G01	CD213a2 / IL13RA2
	Human
					Abnova Taiwan Corp.
H00003598-Q01-10	CD213a2 / IL13RA2
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00003598-Q01-25	CD213a2 / IL13RA2
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.

Catalog No.	Species
H00003598-T01	IL13RA2 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
LY424589	IL13RA2 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.
NBL1-11906	IL13 receptor alpha 2 Lysate

		Novus Biologicals Inc.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH