TA336232 Aminomethyltransferase antibody

Rabbit Polyclonal Anti-AMT Antibody

See related secondary antibodies

Search for all "Aminomethyltransferase"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Aminomethyltransferase

Product Description for Aminomethyltransferase

Rabbit anti Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Aminomethyltransferase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Aminomethyltransferase

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AMT, GCST, GCVT, Glycine cleavage system T protein
Presentation Purified
Reactivity Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P48728
Immunogen:
The immunogen for Anti-AMT Antibody: synthetic peptide directed towards the N terminal of human AMT. Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA.
GeneID:
275
Application WB
Background The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogese). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase; MIM 238300), H protein (a lipoic acid-containing protein; MIM 238330), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogese; MIM 238331). Glycine encephalopathy (GCE; MIM 605899) may be due to a defect in any one of these enzymes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2102 D13811.1 1-2102 2103-2117 BC044792.1 3271-3285
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Aminomethyltransferase (4 products)

Catalog No. Species Pres. Purity   Source  

Aminomethyltransferase

Aminomethyltransferase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Aminomethyltransferase (29-403, His-tag)

Aminomethyltransferase Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

Aminomethyltransferase (29-403, His-tag)

Aminomethyltransferase Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

Aminomethyltransferase

Aminomethyltransferase Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Aminomethyltransferase (4 products)

Catalog No. Species Pres. Purity   Source  

Aminomethyltransferase Lysate(Denatured)

Aminomethyltransferase Lysate(Denatured)
  Abnova Taiwan Corp.

AMT overexpression lysate

AMT overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

AMT overexpression lysate

AMT overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

AMT overexpression lysate

AMT overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn