TA336233 Anti-Muellerian Hormone / AMH antibody

Rabbit Polyclonal Anti-AMH Antibody

See related secondary antibodies

Search for all "Anti-Muellerian Hormone / AMH"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep Anti-Muellerian Hormone / AMH

TA336233

More Views

  • TA336233

Product Description for Anti-Muellerian Hormone / AMH

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Sheep Anti-Muellerian Hormone / AMH.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Anti-Muellerian Hormone / AMH

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MIF, MIS, Muellerian-inhibiting factor, Muellerian-inhibiting substance
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt, Sh
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P03971
Immunogen:
The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG.
GeneID:
268
Application WB
IHC
Background Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Anti-Muellerian Hormone / AMH (1 products)

Catalog No. Species Pres. Purity   Source  

Anti-Muellerian Hormone / AMH

Anti-Muellerian Hormone / AMH Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Anti-Muellerian Hormone / AMH (1 products)

Catalog No. Species Pres. Purity   Source  

AMH overexpression lysate

AMH overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn