TA336239 HMG-CoA lyase / HMGCL antibody

Rabbit Polyclonal Anti-Hmgcl Antibody

See related secondary antibodies

Search for all "HMG-CoA lyase / HMGCL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat HMG-CoA lyase / HMGCL

Product Description for HMG-CoA lyase / HMGCL

Rabbit anti Human, Rat HMG-CoA lyase / HMGCL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HMG-CoA lyase / HMGCL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms mitochondrial Hydroxymethylglutaryl-CoA lyase
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P97519
Immunogen:
The immunogen for Anti-Hmgcl Antibody is: synthetic peptide directed towards the C-terminal region of Rat Hmgcl. Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL.
GeneID:
79238
Application WB
Background Hmgcl is an enzyme of the ketogenic 3-hydroxy-3-methylglutaryl-CoA cycle.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn