TA336243 Alpha-galactosidase A / GLA antibody

Rabbit Polyclonal Anti-GLA Antibody

See related secondary antibodies

Search for all "Alpha-galactosidase A / GLA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat Alpha-galactosidase A / GLA

Product Description for Alpha-galactosidase A / GLA

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rat Alpha-galactosidase A / GLA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Alpha-galactosidase A / GLA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Alpha-D-galactosidase A, Alpha-D-galactoside galactohydrolase, Melibiase
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P06280
Immunogen:
The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF.
GeneID:
2717
Application WB
Background GLA is a homodimeric glycoprotein that hydrolyses the termil alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predomintly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.This gene encodes a homodimeric glycoprotein that hydrolyses the termil alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predomintly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Alpha-galactosidase A / GLA (7 products)

Catalog No. Species Pres. Purity   Source  

Alpha-galactosidase A / GLA

Alpha-galactosidase A / GLA Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Alpha-galactosidase A / GLA

Alpha-galactosidase A / GLA Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

Alpha-galactosidase A / GLA (32-429, His-tag)

Alpha-galactosidase A / GLA Human Purified > 90 % by SDS - PAGE Insect cells
0.25 mg / €1,400.00
  OriGene Technologies GmbH

Alpha-galactosidase A / GLA (32-429, His-tag)

Alpha-galactosidase A / GLA Human Purified > 90 % by SDS - PAGE Insect cells
50 µg / €400.00
  OriGene Technologies GmbH

Alpha-galactosidase A / GLA

Alpha-galactosidase A / GLA Human in vitro transl.
  Abnova Taiwan Corp.

Alpha-galactosidase A / GLA

Alpha-galactosidase A / GLA Human in vitro transl.
  Abnova Taiwan Corp.

Alpha-galactosidase A / GLA

Alpha-galactosidase A / GLA Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Alpha-galactosidase A / GLA (1 products)

Catalog No. Species Pres. Purity   Source  

Galactosidase alpha Lysate

Western Blot: Galactosidase alpha Lysate [NBL1-11104] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GLA
  Novus Biologicals Inc.
  • LinkedIn