TA336244 Galactocerebrosidase antibody

Rabbit Polyclonal Anti-GALC Antibody

See related secondary antibodies

Search for all "Galactocerebrosidase"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Galactocerebrosidase

Product Description for Galactocerebrosidase

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Galactocerebrosidase.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Galactocerebrosidase

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GALC, GALCERase, Galactocerebroside beta-galactosidase, Galactosylceramidase, Galactosylceramide beta-galactosidase
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P54803
Immunogen:
The immunogen for Anti-GALC Antibody: synthetic peptide directed towards the middle region of human GALC. Synthetic peptide located within the following region: LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL.
GeneID:
2581
Application WB
Background GALC is a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy.This gene encodes a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy. Alterte transcriptiol splice variants, encoding different isoforms, have been characterized.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Galactocerebrosidase (7 products)

Catalog No. Species Pres. Purity   Source  

Galactocerebrosidase

Galactocerebrosidase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Galactocerebrosidase

Galactocerebrosidase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Galactocerebrosidase

Galactocerebrosidase Human Purified
  Abnova Taiwan Corp.

Galactocerebrosidase

Galactocerebrosidase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Galactocerebrosidase

Galactocerebrosidase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Galactocerebrosidase

Galactocerebrosidase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Galactocerebrosidase

Galactocerebrosidase Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn