TA336255 ACADS antibody

Rabbit Polyclonal Anti-ACADS Antibody

See related secondary antibodies

Search for all "ACADS"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish ACADS

TA336255

More Views

  • TA336255
  • TA336255

Product Description for ACADS

Rabbit anti Canine, Equine, Human, Mouse, Rabbit, Rat, Zebrafish ACADS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ACADS

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms SCAD, Short-chain specific acyl-CoA dehydrogenase mitochondrial
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P16219
Immunogen:
The immunogen for Anti-ACADS Antibody: synthetic peptide directed towards the middle region of human ACADS. Synthetic peptide located within the following region: FTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEA.
GeneID:
35
Application WB
Background ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogese family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogese Deficiency. This gene encodes a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogese family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogese Deficiency. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ACADS (8 products)

Catalog No. Species Pres. Purity   Source  

ACADS

ACADS Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ACADS (25-412, His-tag)

ACADS Human Purified > 95 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

ACADS (25-412, His-tag)

ACADS Human Purified > 95 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

ACADS

ACADS Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACADS

ACADS Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ACADS

ACADS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ACADS

ACADS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ACADS

SDS-Page: ACADS Protein [NBP1-30305] - ACADS, 44.0 kDa (409aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE
  Novus Biologicals Inc.

Positive controls for ACADS (2 products)

Catalog No. Species Pres. Purity   Source  

ACADS 293T Cell Transient Overexpression Lysate(Denatured)

ACADS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ACADS Lysate

Western Blot: ACADS Lysate [NBL1-07221] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ACADS Protein
  Novus Biologicals Inc.
  • LinkedIn