TA337235 HDAC8 antibody

Rabbit Polyclonal Anti-HDAC8 Antibody

See related secondary antibodies

Search for all "HDAC8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HDAC8

Product Description for HDAC8

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HDAC8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HDAC8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDA07, HD8, HDACL1, Histone deacetylase 8
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BY41
Immunogen:
The immunogen for anti-HDAC8 antibody: synthetic peptide directed towards the C terminal of human HDAC8. Synthetic peptide located within the following region: TGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRIQQILNY.
GeneID:
55869
Application WB
Background Histones play a critical role in transcriptiol regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to D. The protein encoded by this gene belongs to class I of the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter.Histones play a critical role in transcriptiol regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to D. The protein encoded by this gene belongs to class I of the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HDAC8 (8 products)

Catalog No. Species Pres. Purity   Source  

HDAC8 (N-term HIS tag, transcript variant 1)

HDAC8 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

HDAC8 (1-377, His-tag)

HDAC8 Human Purified > 80 % by SDS - PAGE SF9 cells
0.25 mg / €1,070.00
  OriGene Technologies GmbH

HDAC8 (1-377, His-tag)

HDAC8 Human Purified > 80 % by SDS - PAGE SF9 cells
50 µg / €400.00
  OriGene Technologies GmbH

HDAC8

HDAC8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HDAC8

HDAC8 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

HDAC8

HDAC8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HDAC8

HDAC8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HDAC8

HDAC8 Human
  Abnova Taiwan Corp.

Positive controls for HDAC8 (4 products)

Catalog No. Species Pres. Purity   Source  

HDAC8 293T Cell Transient Overexpression Lysate(Denatured)

HDAC8 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HDAC8 Lysate

Western Blot: HDAC8 Lysate [NBL1-11485] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for HDAC8.
  Novus Biologicals Inc.

HDAC8 overexpression lysate

HDAC8 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

HDAC8 overexpression lysate

HDAC8 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn